PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G16860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 428aa    MW: 45139.4 Da    PI: 8.0028
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G16860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-40115191278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      C v+gC+adls+ ++yhrrhkvCe hsk+pvv+vsg+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+qa
  ONIVA09G16860.1 115 CAVDGCKADLSKHRDYHRRHKVCEPHSKTPVVVVSGREMRFCQQCSRFHLLGEFDEAKRSCRKRLDGHNRRRRKPQA 191
                      **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-36107176IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.923112189IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-38113194IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31115188IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MDWDLKMPVS WDLAELEHNA VPNMAAAASA AEPGIAAVAA SRGAPGRPEC SVDLKLGGLG  60
EFGAADALKE PAAAAKAPVS SAAAAASVAK VPPSTSTLKR PRGGGGGGGG QCPSCAVDGC  120
KADLSKHRDY HRRHKVCEPH SKTPVVVVSG REMRFCQQCS RFHLLGEFDE AKRSCRKRLD  180
GHNRRRRKPQ ADSMSSGSFM TSQQGTRFAS FTPPRPEPSW PGIIKSEETP YYSHHHHPHP  240
VMTSRQPHFV GSPSSATTAA FSPKEGRRFP FLHEGDQISF GGGGGAAAAA TLEISVCQTT  300
VVAPPPPESS SSNKMFSSDG LTMATTTTTT AHHHHHHQIP MAQPLVPNLQ QQFGGSSPWF  360
ASSPAAAAVA GGGFACPSMD SEQQQQQQLN AVLVPGSNEN EMNYHGMFHV GGEGSSDGTS  420
PSLPFSWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-28105188184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171188KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1087590.0AC108759.2 Oryza sativa (Japonica cultiva-group) chromosome 9 BAC clone OSJNBa0072P02, complete sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610874.10.0PREDICTED: squamosa promoter-binding-like protein 18 isoform X2
SwissprotQ0J0K10.0SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A0E0IM490.0A0A0E0IM49_ORYNI; Uncharacterized protein
STRINGLOC_Os09g32944.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-39SBP family protein